477cn Fusion Protein

Catalog number: Ag25540
  • Print page
  • Download PDF

Product Name:
477cn-GST fusion protein

Catalog No:
Ag25540

Source:
E. coli-derived, PGEX-4T

Peptide Sequence:
SDPLWLRQKTIQMIDEFSDVNEGEKELMKLWNLHVMRHGFVGDCQLPIACEMFLDAKGTEIVRKNLYRNFILHMCSLFDYGLIAAETVYKTVQKLQGLLSKYAAGQELMQRQREEQLKYWLDVGMHKKQEDPKTLKSPQKPAPPADQASTSSASTSGSGSGSSSMQPPKRMPAHLKRGSAASSPGVQSKGTENGTNGSNSSSSNSKNVAKKSADQPLSTLANTRERRSEYGQKRNVSGSRLAATPASKRKLSSKDNTVLNKRQRYSDGSPGTGIGNGHGGGSGSGANRNKSNNHSLPATS
(551-850 aa encoded by )

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top