4EBP1 Fusion Protein

Catalog number: Ag5056
  • Print page
  • Download PDF

Product Name:
human EIF4EBP1-GST fusion protein

Catalog No:
Ag5056

Source:
E. coli-derived, PGEX-4T

Peptide Sequence:
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
(1 - 118 aa encoded by BC004459)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top