SFN Fusion Protein

Catalog number: Ag0973
  • Print page
  • Download PDF

Product Name:
human SFN-GST fusion protein

Catalog No:
Ag0973

Source:
E. coli-derived, PGEX-4T

Peptide Sequence:
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
(1-248 aa encoded by BC002995)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top