WT1 Fusion Protein

Catalog number: Ag3337

Product Name:
human WT1-GST fusion protein

Catalog No:
Ag3337

Source:
e coli.-derived, PGEX-4T

Peptide Sequence:
MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRMHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLAL
(1-302 aa encoded by BC032861)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay.

Back
to top