Recombinant human BAX protein
Cat no : Ag0576
Synonyms
BAX, Apoptosis regulator BAX, Bcl2-L-4, Bcl-2-like protein 4, Apoptosis
Validation Data Gallery View All
Product Information
Peptide Sequence |
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
(1-192 aa encoded by BC014175) |
Activity | Not tested. |
Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
Species | Title |
---|---|
EBioMedicine OCIAD1 contributes to neurodegeneration in Alzheimer's disease by inducing mitochondria dysfunction, neuronal vulnerability and synaptic damages. | |
Clin Cancer Res Effect of a Smac Mimetic (TL32711, Birinapant) on the Apoptotic Program and Apoptosis Biomarkers Examined with Validated Multiplex Immunoassays Fit for Clinical Use. | |
Cell Death Dis DRAM1 regulates apoptosis through increasing protein levels and lysosomal localization of BAX. | |
Nanoscale Res Lett Cytotoxicity induced by nanobacteria and nanohydroxyapatites in human choriocarcinoma cells. |