COXIV Fusion Protein

Catalog number: Ag1640

Product Name:
human COXIV-GST fusion protein

Catalog No:
Ag1640

Source:
e coli.-derived, PGEX-4T

Peptide Sequence:
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
(1-169 aa encoded by BC021236)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay.

Back
to top