Caspase 1 Fusion Protein

Catalog number: Ag11143

Product Name:
human Caspase 1-6*His fusion protein

Catalog No:
Ag11143

Source:
e coli.-derived, PET28a

Peptide Sequence:
MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
(1-311 aa encoded by BC062327)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay.

Back
to top