Recombinant human FZD10 protein
Cat no : Ag12867
Synonyms
CD350; FZ-10; FzE7; hFz10
Validation Data Gallery View All
Product Information
Peptide Sequence |
SMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVV
(23-229 aa encoded by BC074998) |
Activity | Not tested. |
Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
Species | Title |
---|---|
Clin Transl Oncol The expression and function of Frizzled-7 in human renal cell carcinoma. |