MMP9 Fusion Protein

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Liquid

Publications

1

Cat No : Ag0552

Synonyms

CLG4B; GELB; MMP-9



Product Information

Peptide Sequence MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCG
(1-100 aa encoded by BC006093)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The protein was expressed as GST-tagged fusion protein by E.Coli and purified by Glutathione-sepharose. The purified protein was resolved in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4 ) added with 15% glycerol. The elution buffer contain 100mM GSH.

Publications

SpeciesTitle

PLoS One

Osteopontin (OPN) is an important protein to mediate improvements in the biocompatibility of C ion-implanted silicone rubber.

Authors - Shao-liang Wang