Product Name:
human PAX8-GST fusion protein

Catalog No:
Ag0306

Source:
e coli.-derived, PGEX-4T

Peptide Sequence:
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS
(1-212 aa encoded by BC001060)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay.

Back
to top