Recombinant human PAX8 protein
Cat no : Ag0306
Synonyms
Validation Data Gallery View All
Product Information
Peptide Sequence |
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS
(1-212 aa encoded by BC001060) |
Activity | Not tested. |
Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
Species | Title |
---|---|
Histopathology Tumour-to-tumour Metastasis from Papillary Thyroid Carcinoma with BRAF mutation to Lung Adenocarcinoma with EGFR mutation: The Utility of Mutation-specific Antibodies. |